OR2T4

Protein information for: . MGLFRQSKHPMANITWMANHTGWSDFILLGLFR QSKHPALLCVVIFVVFL.
Olfactory receptor 2T4 is a protein that in humans is encoded by the gene. Olfactory receptors interact with odorant molecules in the nose, to initiate a.
Gene: . Description. olfactory receptor family 2 subfamily T member 4 [Source:HGNC Synonyms. Protein differential OR2T4 in normal tissues. Enzyme Numbers IUBMB. Don't have an account?. Tags proprietary tag N-Terminus. Imagine a global collaborative knowledge base for original thoughts.

OR2T4 - official

You can save favorites, save cart, check order status and speed through checkout with saved addresses, payment methods and more. Please sign in using your account on one of the following social networks.. Tags proprietary tag N-Terminus. Your browser does not have JavaScript enabled and some parts of this website will not work without it. Retrieved from " wikigadugi.org?